SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN21532 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN21532
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily PapD-like 3.14e-27
Family MSP-like 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN21532   Protein: CN26825   Gene: WBGene00160257
Sequence length 108
Comment CN26825 WBGene00160257 status:Predicted
Sequence
MNLTVEPAMATFPATGGTSVHFIVSTVDSRVAFKVKSSNNDNYRVRPVYGFVETKGRAKI
EILRLEGPVKDDKLIIQWAEVPADEIEPQAPFKAGARQGEVTILMRAS
Download sequence
Identical sequences G0MGF1
135651.CBN21532 CBN21532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]