SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN21557 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN21557
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily PapD-like 3.66e-29
Family MSP-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN21557   Protein: CN21693   Gene: WBGene00160282
Sequence length 339
Comment CN21693 WBGene00160282 status:Predicted
Sequence
MPKNPSLLQVIPNRNLVFTGPFTEVTKADLQLRNISSGSVCFKVRTTAPEQYSVQPNSGF
LRPGEWKRLTVSLQPLKGTPPEAGRHKFMIQSCVPPPEYFVDREEIWEVVDPADITLDKL
TVTFLDGGNSRSEETSAAARRAPEFGASCSAPYLQHSGDDRNTSMIREHHESSASAGQTQ
EVPPSYSASQDAAFLSLRESLKANTDENEELKKKVDRLEKLIDVMLKQNMKHQQTQASED
GPSSSTSQYATMQKSQESFADKYEELEKRVDKLEQLSCDELEQNLKHQQTQTGPSPSHSF
SNSQELTIQESLKSLSDENEELRKRVDNLEQLSGVELEV
Download sequence
Identical sequences G0PCG9
CBN21557 135651.CBN21557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]