SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN22493 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN22493
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily PapD-like 0.000000000567
Family MSP-like 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN22493   Protein: CN12087   Gene: WBGene00161218
Sequence length 75
Comment CN12087 WBGene00161218 locus:Cbn-msp-36 status:Predicted
Sequence
MKRLGVDPPCGVLDPKKADLLTVSCNVFAYGQEDTNNDRITDERTNTADGAVKQFRREWL
QEDGMVRRKNLSIDP
Download sequence
Identical sequences G0MBI6
CBN22493 135651.CBN22493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]