SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN22782 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN22782
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily PapD-like 0.0000000000000419
Family MSP-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN22782   Protein: CN07250   Gene: WBGene00161507
Sequence length 159
Comment CN07250 WBGene00161507 status:Predicted
Sequence
MAEKKEKKEEKDSDVFVLKVNTEGVLFTNTRLGDELTAAIIKLTNPTKEKYAFKIKCTSN
EMFKIKLPVGFINKDETIEIPKLQARKVWDVKKFEGVKRIYISFCKPGGTISKDVEKKDE
KKKDDTKSKTEEGKKDGTKEDEDKKDDKKDDKKDDDEKK
Download sequence
Identical sequences G0P0T7
CBN22782 135651.CBN22782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]