SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN22927 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN22927
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily PapD-like 1.83e-27
Family MSP-like 0.00000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN22927   Protein: CN13983   Gene: WBGene00161652
Sequence length 109
Comment CN13983 WBGene00161652 status:Confirmed
Sequence
MSLTADPPACTVPAAGGASTHKLVNAGADKLVFKIKSSNNNEYRISPVFGFIDPSGSKDV
TITRTAGAPKEDKLVIHFGPAPADATDAQAAFGAITPAGTVTIPLSATA
Download sequence
Identical sequences G0PF95
CBN22927 135651.CBN22927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]