SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN23900 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN23900
Domain Number 1 Region: 21-179
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-39
Family Calponin-homology domain, CH-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN23900   Protein: CN18447   Gene: WBGene00162625
Sequence length 192
Comment CN18447 WBGene00162625 locus:Cbn-cpn-1 status:Confirmed
Sequence
MSAFASSDRAEKSGIALEAQQKIYEKYDKNLAGEILQWVQDITGQSFDTQGDADNFVKVF
QDGSVLCNLANALKPGSVKKVNTSTMAFKKMENISFFLKFAEEFVQKSELFQTVDLYEGQ
DPNAVLICLASLARKSEKNFGRSGLGPKEAQGDRREWTDEQLKAGQNVIGLQMGSNKGAT
ASGLNMGNTRHM
Download sequence
Identical sequences G0PFY0
CBN23900 135651.CBN23900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]