SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN24205 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN24205
Domain Number 1 Region: 28-156
Classification Level Classification E-value
Superfamily PapD-like 2.62e-24
Family MSP-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN24205   Protein: CN00263   Gene: WBGene00162930
Sequence length 157
Comment CN00263 WBGene00162930 status:Predicted
Sequence
MADKKSQNQVSTSQCPTNNPFHDAGATSLLNKTGEPPFKLSLNLNKVEFKCTDDKKPIPV
HLKVFNPTNETVCYKVRCTSAEIFRVQPPLGFVKAQETITIIIWYQNQDNKKEALSNKLH
YFAIYHTHSDGRTARELWANSKVEGVRRLPATFIMAN
Download sequence
Identical sequences G0N861
135651.CBN00008 135651.CBN24205 CBN00008 CBN24205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]