SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN24466 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN24466
Domain Number 1 Region: 23-147
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-34
Family Calponin-homology domain, CH-domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN24466   Protein: CN08805   Gene: WBGene00163191
Sequence length 154
Comment CN08805 WBGene00163191 locus:Cbn-cpn-4 status:Confirmed
Sequence
MSQSYHRPRPAGMAGAILDKQANKFNDVEAGYLLEWIRDLTKEEIDCEPSRDNFREQLKD
GSRLCKLVNAIQEGSVKKIMKPISNFNCLENINQFTNAARKLGVKDEETFQSVDLFDGRD
LFSVTVTLQSLARKVEKLGIAPPKQVSKDQIVNM
Download sequence
Identical sequences G0NDP1
135651.CBN24466 CBN24466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]