SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN24542 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN24542
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily PapD-like 1.57e-16
Family MSP-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN24542   Protein: CN21884   Gene: WBGene00163267
Sequence length 112
Comment CN21884 WBGene00163267 status:Predicted
Sequence
MSLTFNTSSLKWVAPEGQAIVKISNATQSRFAIKVKTTNVDVYKTTPNTDFINPGFTLNL
VVCRSKAPMKEDKLCEFTENDAAEFFKRPTVKPNVYMITMKCDEQPPLPGAP
Download sequence
Identical sequences G0NTN9
135651.CBN24542 CBN24542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]