SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN24891 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN24891
Domain Number 1 Region: 97-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 7.19e-22
Family Skp1 dimerisation domain-like 0.00032
Further Details:      
 
Domain Number 2 Region: 20-85
Classification Level Classification E-value
Superfamily POZ domain 1.44e-16
Family BTB/POZ domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN24891   Protein: CN13105   Gene: WBGene00163616
Sequence length 182
Comment CN13105 WBGene00163616 status:Predicted
Sequence
MVLFGNESSSKVDKNLDDCFILVSSDKKEFPISQQAIKHSKTLAQMISTLNISTNSDEKR
IPVENVQGEHLDLIVQWCEHHKEEPVLEDEKSIDQDFKIPDWDRTFLEVDNETLFHFICA
ANYLDIELLMIMACKTVALMAKGRTPEEMRVIFGVNVDEEEQLMMQTNAAPQVEIVEAER
EE
Download sequence
Identical sequences G0PHG5
CBN24891 135651.CBN24891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]