SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN24996 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN24996
Domain Number 1 Region: 7-82
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase N-terminal domain 1.83e-16
Family Epsilon subunit of F1F0-ATP synthase N-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 136-186
Classification Level Classification E-value
Superfamily PapD-like 0.0000275
Family MSP-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN24996   Protein: CN01110   Gene: WBGene00163721
Sequence length 399
Comment CN01110 WBGene00163721 status:Predicted
Sequence
MVGLEPSPNTAVFSDAVVKQVDVPTLAGMVGVLANHVPTIGVLKPGVVSVTTTEGSVQRL
FVSSGTLSVNIDGSCQVLAEEVLKVEDIDESAARAELESAQRASGEGSEVARAEAQGSEK
TTEYLESLNETTERLQRIDMAQSNTNNDRITIEWTNTPDGAAQQFRREWFQGNGIVRRKS
LSIDYNGMKQIVTPEDTTQNEKSEEGSPELTLTSKLKHMTIRIKEEEEPQEKMVVEQKQK
KETKDVFKSKSSPPQFTVIQFIQILEPYIHATLPQEECCGIDDLLQKRASKRKNEVIDSR
RLHHLTRNVLYTVEETAREAYKTNGIINFSVASLLENTKKLVQQLGMEDLIEDWEVLKLA
SKPDDLKNMVVFEDGYSKENDYDFRCTTLNESFLLSRLF
Download sequence
Identical sequences G0MZC8
CBN24996 135651.CBN24996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]