SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN25663 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN25663
Domain Number 1 Region: 12-128
Classification Level Classification E-value
Superfamily PapD-like 2.88e-18
Family MSP-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN25663   Protein: CN37469   Gene: WBGene00164388
Sequence length 301
Comment CN37469 WBGene00164388 status:Predicted
Sequence
MTTTSSAVVPDLTKVVFNPSKSVTFVPVAKKQCVNVEITNNSTSDVAIKFKNTAPGVFKT
SPPTAKIGVGQKKIFQCLFHGLAKDKCKSNDRFTIVYIAVSKNAVIEKALKNAPKTASKK
HKIAILFQGINDQKENETQQPTNNEEEDDKDRQGQMRSKSKAESKAKKVLFYYSKHLIHG
VTSNEAAAAGSGNPNSEFRTTRPAGAFTGQVASNEAGGAAANPKSDFRTTRPAGAYTGQV
ASNTAAGAPVDPNNNGLRTTRPAGAYNNQVTANAGASAENADFKSTKPAGAYDNPQQSNN
K
Download sequence
Identical sequences G0P4B7
CBN25663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]