SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN26090 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CBN26090
Domain Number - Region: 13-63
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00837
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN26090   Protein: CN23524   Gene: WBGene00164815
Sequence length 231
Comment CN23524 WBGene00164815 status:Predicted
Sequence
MELFPSIKLAALDDVICQLCDLKNHTALKCTAPMRTKKYYVESKKLCNRCLSNTHETSKC
ESSMCCHTCKEAHHTALHEMRPVNGVEPEDIRPCPYCSKNHRATQCQLPSHSKKILLDLQ
NRCSRCLMKNHQHHLCKRPFLIYGTVLFRHCSISKEPPKKKTHKLWGILLKNKKQNIIST
NFNSGKFMITLSFHLIISSTVINQLITFLHGITTENNTVKIDRANFTPIQI
Download sequence
Identical sequences G0MM81
135651.CBN26090 CBN26090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]