SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN30516 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN30516
Domain Number 1 Region: 4-109
Classification Level Classification E-value
Superfamily PapD-like 2.88e-21
Family MSP-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN30516   Protein: CN33415   Gene: WBGene00192481
Sequence length 109
Comment CN33415 WBGene00192481 status:Confirmed
Sequence
MAEKKEKKEEKDSDVFVLKVNTEGVLFTNTRLGDELTPAIIKLTNPTKEKYAFKIKCTSN
EMFKIKLPVGFINKDETIEIPVYHMANKAIPENNKQYFAIYYTKVDDDD
Download sequence
Identical sequences G0PM24
CBN30516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]