SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN31571 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN31571
Domain Number 1 Region: 32-162
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.45e-28
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN31571   Protein: CN34612   Gene: WBGene00193536
Sequence length 183
Comment CN34612 WBGene00193536 status:Confirmed
Sequence
MKFFIALALLGAALASSHFDRSIERDIQESSFRAGREYRYLFNGQLSAGLPIPTTPQGIS
RIQTQVNLQWTDGNTVRMQLQKTRFATSQEETNSQKMLPFERFEEVDRMDREHQQLLAMP
VEFDYENGLVREIRFTEDDQPWSENIKRAVINMLQVNILKKEKHEGAEKSENQEPTFAFT
NVE
Download sequence
Identical sequences G0PM10
CBN31571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]