SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN31912 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN31912
Domain Number 1 Region: 154-302
Classification Level Classification E-value
Superfamily E set domains 0.00000203
Family Arrestin/Vps26-like 0.021
Further Details:      
 
Weak hits

Sequence:  CBN31912
Domain Number - Region: 74-123
Classification Level Classification E-value
Superfamily E set domains 0.0105
Family Arrestin/Vps26-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN31912   Protein: CN33207   Gene: WBGene00193877
Sequence length 403
Comment CN33207 WBGene00193877 status:Predicted
Sequence
MKHKRAIRLLVPDRPLKAGSKELVELSLRIPNAVQILESNAVFEGVCRATFSGQDSQHTL
IKEKLHIPFSVIQLPTTKGIDVIPEGHHRLPIFLNVPHHMPGTFNGKFGAIVYRFLIKLK
VKRFSSGDEGTIECEKAVDVLGRVSLDQQPSFAQPVSIDRHVKKKAFFMNRLEAHIKFEI
ERAAYTVGEHILVTGEIKNEHLSNPIKHVSLELRQHILYASGDAQRSDSRLITRLILGSV
PPNETFAVFHSFQIPFDCYPSLCWNGNPVQVTYELLLTNSGCFEIGTPVFLGNCGSPSAS
RRSLMYPESTSGDAPPSTTTYYCVPPTEMSFSPDPPPYSTFGKADPVFIPIHMLKTPYRP
FAPAYHMPGMFHHQGPPKYDYNLNQRMPESPPPPRFLKIEEIE
Download sequence
Identical sequences G0PDD7
CBN31912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]