SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN32186 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN32186
Domain Number 1 Region: 3-39
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000152
Family Calponin-homology domain, CH-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN32186   Protein: CN34960   Gene: WBGene00194151
Sequence length 47
Comment CN34960 WBGene00194151 status:Predicted
Sequence
MESAKYAITCGRKIEAFPEDIVEVKSKMVMTVFACLMAQDCKMEGPM
Download sequence
Identical sequences G0N037
CBN32186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]