SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBN32447 from Caenorhabditis brenneri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBN32447
Domain Number 1 Region: 261-375
Classification Level Classification E-value
Superfamily PapD-like 0.0000000000000471
Family MSP-like 0.0034
Further Details:      
 
Domain Number 2 Region: 55-161
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0000000589
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBN32447   Protein: CN33034   Gene: WBGene00194412
Sequence length 385
Comment CN33034 WBGene00194412 status:Predicted
Sequence
MRILLVRTPIVVFKSKELPEMKLSYDVSVNNQISVEKSNILSEFISKDSSNGNKMRHLTM
FFIHWSRTNKLLGGVYSDEKLEKKLKFNSYILHHMIIHFVQTAANVSLLNTSEKPENRVR
TYNFDDIFHGYSGCLRELFSYYLHFDYENMGIFGSQVMEKSCVSRRHPIITEADERESRK
GDTEVSRNGTVVNSIVPSASKVSDVTNENKQDVVQNEKSTMKQEEEKAKQDNGKSQQTEK
NNEKKPMSNINHNFYYENSEFSVTVDPSGDLMFKMESKSQTRVTFKNISNEKVMFKIKVS
DHSYKYFYYPRLHVLIGNCFSICPVFGILEIGESSDVVVTHTPSQCKEAKMVIVNSKYVG
EVDLAKSFRNLKPTGGPISINLVAN
Download sequence
Identical sequences G0P4B5
CBN32447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]