SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA00701 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA00701
Domain Number 1 Region: 6-56
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000186
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00087
Further Details:      
 
Domain Number 2 Region: 55-107
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.0000000000706
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA00701   Protein: PP01359   Gene: WBGene00090255
Sequence length 117
Comment PP01359 WBGene00090255 status:Predicted
Sequence
MATTEYQLYRETTMGMALTEVLDQMIEDHLIPKTLAMKVLGTFDKNMNKALAQRAKTKYQ
FKADKLVAYRYCDNVWTFVMADIEFRDYYRTLDGKHPRVKFVACDGRMAITGVPAPH
Download sequence
Identical sequences A0A2A6BQT0 H3DTH0
PPA00701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]