SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA00702 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA00702
Domain Number 1 Region: 4-54
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000068
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0014
Further Details:      
 
Domain Number 2 Region: 53-104
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.00000000000837
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA00702   Protein: PP07824   Gene: WBGene00090256
Sequence length 115
Comment PP07824 WBGene00090256 status:Partially_confirmed
Sequence
MATYQLYRNTTVGQALQQTLNDFQAEDIISRALAERVMATFDKVINKTLNTKAKNKMNFK
LGYAEKLRAYRFCDNVWTFVMEKVEFREAITAPKERLKIVACDGSNKTLAPPAAP
Download sequence
Identical sequences H3DTH1
PPA00702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]