SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA02806 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA02806
Domain Number - Region: 29-93
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00275
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA02806   Protein: PP11289   Gene: WBGene00092360
Sequence length 99
Comment PP11289 WBGene00092360 status:Predicted
Sequence
KAKGDEIEKENENGDEKGKDNGLRKKTLKIKATMRDGKVKNLFAHMHTTVQALIVQAGAT
APCSLFHDGRKVAYARSLRSIESVVEAEKEAEEIEVDIY
Download sequence
Identical sequences H3F8W1
PPA02806 PPA18613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]