SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA08314 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA08314
Domain Number 1 Region: 5-408
Classification Level Classification E-value
Superfamily Nucleoporin domain 1.23e-21
Family Nucleoporin domain 0.013
Further Details:      
 
Domain Number 2 Region: 420-487
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000000275
Family MgtE N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA08314   Protein: PP19986   Gene: WBGene00097868
Sequence length 501
Comment PP19986 WBGene00097868 locus:Ppa-npp-14 status:Predicted
Sequence
MPLDFEFHALRKVRLTSTALTGDTSRRLAISSSYGIGIAIVAANRLLSFYTDDVHAQKAD
RTNINEEVTGVRTRTTNYFDEKASLVAVSCNCDGTLMGVLADTPAGPMVHVFDAAAFSLD
YQGHISPLTTVRVSAEPGATARCFEWSPAAADTLVAAASDRSLITVAVKAEILHSQSASY
TMVGEKRLGAAVRAMSWSRKGKQLVVGDDLGKVVQMKPELDVLGEKLVKVELDAIVRSTM
PPETCTIASPAVVGLCWMTTTEFLVVYGNQAAKDVQATIMITKKDKPITWTELADLAYGS
PHSALSPVVTSLCLLEWNALLTTNTKSSEVSMVGKTGEVWQVWVPDELHQASLPTNAATA
ETFPIGAELDFSASEQVVLSDDHQTRVAASPILFVLTTDGLLMGYHTVNLNQGALSVQEI
EELEYSQCASVIEELEYSQCASVIEELEYSQCASVIEELEYSQCASVIEELEYSQCASVI
EELEYSQCASVSHYGIAETEM
Download sequence
Identical sequences H3EF06
PPA08314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]