SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA09359 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA09359
Domain Number 1 Region: 81-131
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0000000000000116
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0013
Further Details:      
 
Domain Number 2 Region: 9-83
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.0000000000000288
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA09359   Protein: PP18400   Gene: WBGene00098913
Sequence length 143
Comment PP18400 WBGene00098913 status:Partially_confirmed
Sequence
MANNGKVADKVCLIVIDGWGISEESHGNAILNAKTPVMDGLCSGNWTQLEASGEHVGLPE
GLMGNSEVGHLNIGSGRPVYQDIVRINMACRQNTLVKNENLIAACERAKKGTGRLHLAGL
VSDGGVHSHIGVFWNDFVDKMCL
Download sequence
Identical sequences H3EHY9
PPA09359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]