SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA09360 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA09360
Domain Number 1 Region: 24-184
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 2.75e-50
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA09360   Protein: PP01823   Gene: WBGene00098914
Sequence length 199
Comment PP01823 WBGene00098914 status:Partially_confirmed
Sequence
MAMLSPEVFDLRLIVWSITDKVGDHLFALVKATKELGVPQLYVHFYGDGRDTSPTSGAGF
LQQTIDFLVAQGHGKLATVVGRYYAMDRDKRWERICVAYEAMIGGKGEESTVDKVVDVVK
ARYAANETDEFLKPIILEGAEGRVRDGDTLIFFDYRADRMREISEVMGMERYKDCASALT
HPKDVQKYGGLPKRAVALV
Download sequence
Identical sequences H3EHZ0
PPA09360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]