SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA10693 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA10693
Domain Number 1 Region: 63-274
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.87e-56
Family Proteasome subunits 0.00000213
Further Details:      
 
Weak hits

Sequence:  PPA10693
Domain Number - Region: 588-641
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.068
Family MgtE N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA10693   Protein: PP04108   Gene: WBGene00100247
Sequence length 674
Comment PP04108 WBGene00100247 locus:Ppa-pbs-5 status:Partially_confirmed
Sequence
MWGLTCREDERDTEDALGETFDATAIEAPVSGQFTFPNPPLGLQPKGFVNAHFGPDSSAK
SLQFRKGTTTLAFVYEPLTEKDVGGIIVAVDSRASAGEYISSKSVMKILDVSEHMVATMA
GGAADCQFWCRTVNKYCNLFELRERSTITVSAASKYFANVLYGYKGQGLSVGSMVAGYDK
RGPQIFMVNSEGDRTLLKVCSVGSGSLNAYGILDTYYKPKMSDEEAMSLGRRAIMHATYR
DAGSGGVCNLVHITPTKKIRYPGVDVSKLWYEFADEIGRDIANSHVYGRRWSIDRISMAL
EQLTPDQQQVYWEVKEWFPHASRAALITHIGQGLDDYSHALIALCVDETIPWMIYALIAL
CDDGTIPQDDYDPEDLKAEEQRETTELERAMRASVLTEQHSQLLQQPHQLEPQVVRVMHV
GAATAGLAAGAAAPLLQQLQQPVAAASKPTAAAAAAAAAAPPPAQAQPQCSICKKSTSSV
ARCHWPINKATGDLKEEDPNAHACCAKCLTSRYVFKKITITSRVAISCLKKGCTREIHQD
RLVSDAGLKPALAHWMLGFTEVTVGNARRDNTVRELKRAREEEPEITDEERERLTVIMDH
MDHDKFAYLVDQLPGVDFIWLLDNIDCGTVEMILDRREHEDTVPKRRRRRLDKKGVTNLV
EFHLLFVAVASREI
Download sequence
Identical sequences H3ELQ1
PPA10693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]