SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA12998 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA12998
Domain Number 1 Region: 378-433
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 3.14e-20
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00031
Further Details:      
 
Domain Number 2 Region: 15-56
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000628
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA12998   Protein: PP15750   Gene: WBGene00102552
Sequence length 433
Comment PP15750 WBGene00102552 locus:Ppa-pqn-51 status:Predicted
Sequence
MMRLRNVHRSGLVLVQSDIYRSVISDVIAQVKEAFLDESIDIDVLNQLKKDWEEKIAQSG
CVDMDPKPGPPPTNSMGAVRAAAGMPPNMVVHRPQPQQVAHHHHQQLQQQHLQIQPTTQQ
ILAQQQRITQQQQIQEQQQLAQQQAQQAAARQQQALLQAQLQQHQVQQQFQAVHALPLQM
AGMNGMQGVYMQQAAARAVPLQQYAGLVPGGLMNVPQQVMVLSGGQSTPVPFSALNAQQR
MQVLGQMQQQQLQQQQQQQQQQDHVHQLDGSGGLREDVPCSSVSLKDRKTTGKMVKKAGK
QPTRKEAERVARQLGILQLDGGRAGGGGGMSDSSSEEEEEEEDDPLRRMADRIGDEGEEQ
DGDGVHEDPLNSDDDQSDDEDLVTLFDAEDVVMCQFEKVSRARSKWKFSLKDGIMHINGK
DFCFQKCTGEAEW
Download sequence
Identical sequences H3ET76
PPA12998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]