SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA14927 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA14927
Domain Number - Region: 59-122
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00562
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA14927   Protein: PP11017   Gene: WBGene00104481
Sequence length 128
Comment PP11017 WBGene00104481 status:Predicted
Sequence
NKVFPGTHLLPQEVAPAMRLGKPIPPPLKKVKGDEIEKDNENGDEKGKDNGLRKKTLKIK
ATMRDGKVKNLFAHMHTTVQALIVQAGATAPCSLFHDGRKVAYARSLRSIESVVEAEKEA
EEIEVDIY
Download sequence
Identical sequences H3EYL4
PPA14927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]