SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA16543 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA16543
Domain Number 1 Region: 1358-1716
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.44e-127
Family Hect, E3 ligase catalytic domain 0.0000000281
Further Details:      
 
Weak hits

Sequence:  PPA16543
Domain Number - Region: 492-556
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0249
Family MgtE N-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA16543   Protein: PP25029   Gene: WBGene00106097
Sequence length 1723
Comment PP25029 WBGene00106097 locus:Ppa-eel-1 status:Partially_confirmed
Sequence
MAERGIGGGFAVLRGTGGPLDTHRNRLHLIRQNAVRRNRDTHARTEADFRRLLDLHARIG
GGGADHQMLGGLHASWRPLESAYEGLFGGYGSGATYAGGNERGLAAEDHHARMTSRLLTE
SCPSTMDRYRESGRVLDDVHGHIMAALANSIVYYKLKKEEAEARAKAEEEVKAKREEAEK
KAKEEEEKARAERVARGEVDDTVSDVTSVTARSDDAVTAREIGDDEEEMEQTEGAVAARG
GEEAMDVMVVPPPPTEEPEVLTSPDEEEPSTRAAADTDGADADEEDNNMDTTSPPASHSL
PPTIVSMVGGGEEMGDNSNGSSTGATIGDETSQSGGGEMAAAAAAAANQPPVLEQQQPIV
DPNAAVHIVAAPDGTPLQAVPPEYVDILGTDFLPCGVDAAFLAALPDDMREEVLRDHDRQ
MRQQARAAVPPAAPAAAAAPAATTVADAAAPAAPVDGAASAAPATAAEAAPAPATTGPLA
SAPGVEPLDPDFLSALPAELQAEIIEQHERAVRAALATAAAAAAPAAPPPADDGAEVIRS
LPPSLRAQVLADADDTVLAALPQDMQDEARRLRTERGVHVARMQMERDYHRQPRMVVRAP
GGVRGTLHAGRAAAAAQAQSGVGQMAGSTLTASTKGIQMLDRDALSALIIMFFADARLSQ
PRLQKTLRDLCTHKGTCDYLIYALLAILKQISENKHTEEEGEKPSESKSWTDTITVSGVG
HNERVIKIDKDGGVSIHPMHAPTVAKNVVDLLVTIARHYPGHFIPHALRKEGSSTKGVEP
SPSAVPMPPFEHFWQTVYAYTTSKPGTGAKEALLEHRVDTLEVSPLSCCMALLQTPVMKT
TAGLNEKLLRLVYTIVQTLPDDTLVRMSSNNKEASTAMLTATGEETPLCEQMKLICDLLT
SGTLSTEALHDGRLLLVEAMRAMNFRTTATIYEMLVKRIESLGSQLKPQISLLMSELSAV
PEGSGPSTSKAGSSKYDADLSREQRRRTEMERENMFQALHQIRNDQRPTGVMSSCAELQV
PSVKALQEKGGVQAALLVALQTMCKTRDTLGLLMADRKRARTDVAQKKLDKAKKEYDERK
KKAETEAAAAATAAALAAPADASAADAAPASTTEAPAATETPAAPSALAADAAQPAVGFT
TFTQSAAAAPQPPPAADAAAAPAAPAAPAAPAAPAFVFAEAPPKLEDFLEPETADPIPEL
KLSAQLTSLEGLWSVLSDCLLRLGRASDPHAILVLQPAAEAFFLVHAVTAEKAREAALSR
EQAAAAAAPAAGGASPGPAPISASTSTDAASIAAGDEDTTKLLQFAEKHRSVLNQVLRQN
QASLQDGPFAILAACPKLLDFDVKRTHFRKQLGRMDDRQRYRRDDVPLRIRRAHIFSDSF
RELFRLRGNEWKSRFYIMFEGEEGQDAGGLLREWFSVITREIFNPNYALFNTAPGDRSTY
MINKASYINPEHLDYFKFVGRIIAKAIHDNKLLDCYFTRAFYKHILNLPVKYQDLESEDP
EFYKSFDYLLNNPVETMGIDLTFTLEVEEFGVVSTRPLKEGGADIIVTDENKEEYVRLVC
QMKMTSSIRRQLDAFLDGFYDVIPKTLIAMFNEQELELLISGLPDVDIDDLAANTEYRSY
TKNSKEIQWFWRALRSFEPEDRAKFLQFVTGTSKVPLNGFTALEGMNGAQKFSIHQDSRT
GNRLPAAHTCFNQLDLPVYDSYEKLREALLLAIRECTEGFGFA
Download sequence
Identical sequences H3F354
PPA16543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]