SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA17355 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA17355
Domain Number - Region: 59-121
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00602
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA17355   Protein: PP21346   Gene: WBGene00106909
Sequence length 125
Comment PP21346 WBGene00106909 status:Predicted
Sequence
NKVFPGTHLLPQEVAPAMRLGKPIPPPLKKAKGDEIEKENENGDEKGKDNGLRKKTLKIK
ATMRDGKVKNLFAHMHTTVQALIVQAGATAPCSLFHDGRKVAYARSLRSIESVVEAEKEI
EVDIY
Download sequence
Identical sequences H3F5C8
PPA17355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]