SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA20121 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA20121
Domain Number 1 Region: 284-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.14e-26
Family RecA protein-like (ATPase-domain) 0.058
Further Details:      
 
Domain Number 2 Region: 123-221
Classification Level Classification E-value
Superfamily DNA primase core 0.00000123
Family Primase fragment of primase-helicase protein 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA20121   Protein: PP21683   Gene: WBGene00109675
Sequence length 543
Comment PP21683 WBGene00109675 status:Predicted
Sequence
MHVDIVKPMISQAFDRVLKPRFTASRAERLLPMAVDANIRYIWDDSTPIAEVDREEKVEL
LELCMMLGIETISMDTLSRFNCRVHMNNYDHPALCYPRYRGPVSRGRVPHGLKLIRRIKD
KLEKENFPIDEPRFTGMFGLHMATLADRKIVVTTNERDALAVYDASGMLTVSLPKGELID
EQVIPYLDDFEVIYLWYPHRHLDYARDFASLLNANRCYLIKNNDRPIELLRQNRSREIPL
IIQEEAIQVRNRGFRSMIDVREDIKQEIINSKPRLHGMAQWKRFDALNRYLMGFRPGELT
VLTGQTGVGKTTFLCEYALDLFNQGVRTLFCSFEMSDEHILRWMLVQFAGVPLHRVENHP
LVEQWLDRFERTKGSLTMMKKSEFRDRSIKEIFEAIKNHVIANGTQHVVIDNLQFLVGMS
LVNDDGANSMDRFNAQDRLVGMLRRLATDYGVHVTLVVHPRKTDSDADLDVQHFGGSARV
TQEADNVLAIQKRRDDVSRKPRKFLYILKNRYTGRIVEHDALEMIYQPATYSHTIVDLAK
AKV
Download sequence
Identical sequences H3FD15
PPA20121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]