SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA21597 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA21597
Domain Number - Region: 20-56
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00889
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA21597   Protein: PP26015   Gene: WBGene00111151
Sequence length 56
Comment PP26015 WBGene00111151 status:Predicted
Sequence
MNRIFYLELATSPSMLFSIVFVLIIEWRVARRVRSVVTEDGRDINHFDNLRRVWQT
Download sequence
Identical sequences H3FH53
PPA21597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]