SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA23740 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA23740
Domain Number 1 Region: 88-201
Classification Level Classification E-value
Superfamily FKBP-like 2.68e-25
Family FKBP immunophilin/proline isomerase 0.0000396
Further Details:      
 
Domain Number 2 Region: 40-77
Classification Level Classification E-value
Superfamily WW domain 0.00000000000252
Family WW domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA23740   Protein: PP15855   Gene: WBGene00113294
Sequence length 203
Comment PP15855 WBGene00113294 status:Confirmed
Sequence
MGDVEDRKRSAEEEKEDAETSSSEKVEEGSSEKKKARKEDDGPLPAGWEKRMSRSKGRVY
FFNLFTGTTQWEKPMDPAERPKNHDIAEVQCMHLLVKHAGSRRPASWRSDHITRSKDDAR
NILNGYAKEINEQSCLAEKRAKFRALVKEFSDCSSASKGGDLGFFNRKTMQPPFTKASFA
LDIDQMSDIVDTDSGLHLIWRLA
Download sequence
Identical sequences H3FN80
PPA23740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]