SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA16781 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA16781
Domain Number 1 Region: 292-437
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000000021
Family CBS-domain pair 0.008
Further Details:      
 
Weak hits

Sequence:  PPA16781
Domain Number - Region: 529-574
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0817
Family cAMP-binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA16781   Protein: PP12315   Gene: WBGene00106335
Sequence length 689
Comment PP12315 WBGene00106335 status:Predicted
Sequence
MRESLIASSILKYICAILVILHSTHARIDDADQILENELPSIFGMRVELPPDNPFGYNPY
GICAVAPDEEFKIVIYGNHLDKVDKLIFTVSDNCSDPAYVVDPVNSFLTHFQHKIGVIVL
LLCLSALFSGLTLGLMSLTPMELELVIKSGSPKEQEYAKAILPIRKKGNLLLCALLLGNV
IVNAAISILFGELTSGLLALAISSLGIVIFGEIIPQSICVKKGLAVGAHTIMITQFFIAL
TYVLSWPVSKLLDCLLGEEYEGYDRKRLMELMKMSMKENGLLSNELKIAVGAMELADKVV
EQVMTKIDDVFMLPDETILNAKTIAEIVQIGYTRIPVYSDGDRNNVTDLALLDPDDNFSV
RTVCGYHQHLVKYVFNDTPLAIVLESFKKGDGHLAMVKRVHVSEESVEDPSYNLVGLVTL
EDIVEEILQAEIVDEFDVVTDNKGRSKTARGKKNDLTRYFEKEAPHTQVSSHIQMVTLQF
LVSNEVAFSDKYVHKGILERLISTSTRRVDMSYIKSAGGTESGVPKLAKLYTKDELSDRY
VLILEGRAKVTIGQSGMMFEAGPFHAFGQELLVKLLAAANTLNRSNSVIDPTEVGCRRPD
LMFKPDYSVTITEDCTYLEVTISSFINAYRSTLMLRDKEAYVDGRDGRHLFFACLTFFIG
AIIARRYCTYLRSIYRKHTQWHTTSNSAC
Download sequence
Identical sequences H3F3T2
PPA16781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]