SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA22616 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA22616
Domain Number 1 Region: 373-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.39e-39
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00078
Further Details:      
 
Domain Number 2 Region: 307-379
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000275
Family Domains B1 and B5 of PheRS-beta, PheT 0.012
Further Details:      
 
Domain Number 3 Region: 8-89
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000076
Family Domains B1 and B5 of PheRS-beta, PheT 0.01
Further Details:      
 
Domain Number 4 Region: 219-260
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000732
Family B3/B4 domain of PheRS, PheT 0.023
Further Details:      
 
Weak hits

Sequence:  PPA22616
Domain Number - Region: 621-666
Classification Level Classification E-value
Superfamily Tropomyosin 0.1
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA22616   Protein: PP16007   Gene: WBGene00112170
Sequence length 776
Comment PP16007 WBGene00112170 locus:Ppa-fars-3 status:Partially_confirmed
Sequence
MPTVGIQKPDLDKHLERVYNQEQFEELCFDYGLELDDITSEKQSAEKEKGVAAGEKLSDV
EVYKVDIPANRYDLLCVEGLSRAIKIFQGRMEQPDYKIVPPASGKLERIVVKPQTKGVRP
FVVGAILRDVTIDDRSYASFIDLQDKLHQNICRKRSLVAIGTHDLDTVKGPFIYNAEKPS
EFKFIPLNESKEFTAEQLMVHYSGESHLKPYLPILAGQSHYPVIRDANGIVCSMPPIING
DHSKITLKTKNIFIEATATDLQKAIVVLDTMVTMYSQYCKKPFTVEPVEVEYEEDGRVES
YPKLSYRERTVKVSEVNTKMGFSLEGEEMASLLVKMSLKAKALDQHTLHVVIPPTRHDIL
HECDIVEDVGVAYGFNKLELRLPSAHTVATPLPLNSVSDHLRIGLSNAGFTEALNFALCS
KDDSSTRLRRPLENAVIISNPKTLEFQMARTSLLPGLLRTVQANSHMPLPLKLFELQDVI
LADSTHEVGARNERRVGAIVYAKQAGFEMVHGLLDRLMILMDVKMSKDRSGYYIQAEDDP
AFLPGRCASIIAPGGKKIGHLGCLHPEVITSFSLSLPTAAIELTIEPFMYSDALLVIGIA
ICTAAAGEGLTYLLVYRQPEYQRLKNEMERKTKKLEKKKETANDDSKTVKRKIEREEERL
KATNRDLSMFKMKSMFAIGLVFTALLSTFSSIFEGKVVAKLPFIPFSLLQNLSHRNLVGE
DLTDCSFIFLYILCTMTVRTNLQKLLGFAPSRAMSKQQGGGMFVPPAHNSQFSYLK
Download sequence
Identical sequences H3FK11
PPA22616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]