SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PPA23425 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA23425
Domain Number 1 Region: 2-26,115-192
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000413
Family CBS-domain pair 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA23425   Protein: PP10951   Gene: WBGene00112979
Sequence length 278
Comment PP10951 WBGene00112979 status:Predicted
Sequence
MNLIGSVSRHTLNSILDDQIGSSTRRAEASQRFYATMPYSDAAFDALHNSSSEKSACCNF
EERISLEGSSQESFKQKQINRYFEVKNKIYKYFRSCFGSSSPCAENSNSASKDDGGKHID
LIEHERIAWEQSRLTEIINVATLKIDTSPFVLPARTTLYKMHSLFSLLGLNRAYVVLRGH
LIGVIALREVREIVELGQSGLLRSLDSDDEESDDTGIPRDLQHLNVGLPGVVAHSIYDGD
DSDYEDNLQSQERKVMPEGDVLKSSHLGKYHKHIQNTK
Download sequence
Identical sequences H3FMB9
PPA23425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]