SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374294610|ref|YP_005044801.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374294610|ref|YP_005044801.1|
Domain Number 1 Region: 8-233
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.75e-56
Family PP-loop ATPase 0.0000579
Further Details:      
 
Domain Number 2 Region: 378-458
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.23e-23
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.021
Further Details:      
 
Domain Number 3 Region: 214-310
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000000000173
Family MesJ substrate recognition domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374294610|ref|YP_005044801.1|
Sequence length 468
Comment tRNA(Ile)-lysidine synthetase [Clostridium clariflavum DSM 19732]
Sequence
MITRVLSTIRKNNLIKNGDCIVVGVSGGPDSICLLHVLWSLRNDLNLKLVAVHINHMLRG
DESYRDEEFVKSFCKKLGVELKSIRVDINKAARQKGMSLEEAGREERYRNFEMVADSIGA
DKIAVAHNKNDQAETVLMNIIRGTGLDGLKGMDYIRGRIVRPLLDIERSEIEAYILEKKL
ETVIDSSNLEKIYARNKIRLDVIPSIDNLFDCSLVKSIDRMSRLIKDDMDFIDGKVRKAY
CDAVLRKENGEVELLLRKIKKMHIAIKRRVIRKAIEEVKGNVKEIESVHIEKILEMINSG
KVGSRIDLPGIKAGRTYESIRFYKKERQTESFSFEAVLNIPGITEMGDGKYCIEASVITD
CNINDFKGMNGSSLIQFFDYDRVIEGINIRKRKEGDLFKPINSNGTKKLKEYFIDNKIPR
EIRDNIPLIAKGNEIVWIIGYKISDKFKVTENTKKVLKLKYKTNMHRL
Download sequence
Identical sequences G8M070
gi|374294610|ref|YP_005044801.1| WP_014253515.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]