SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374295705|ref|YP_005045896.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295705|ref|YP_005045896.1|
Domain Number 1 Region: 208-403
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.89e-75
Family B3/B4 domain of PheRS, PheT 0.00000422
Further Details:      
 
Domain Number 2 Region: 471-689
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.41e-47
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00023
Further Details:      
 
Domain Number 3 Region: 35-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.69e-45
Family Myf domain 0.0022
Further Details:      
 
Domain Number 4 Region: 697-795
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 5.49e-32
Family Anticodon-binding domain of PheRS 0.00036
Further Details:      
 
Domain Number 5 Region: 410-479
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.29e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374295705|ref|YP_005045896.1|
Sequence length 796
Comment phenylalanyl-tRNA synthetase subunit beta [Clostridium clariflavum DSM 19732]
Sequence
MKAPLNWLKDYVDIDVSPKEFADAMTMSGSKVEGIEVQGEEISNVVVGKIISVEKHPNAD
KLQVTQVDIGSEVIQVVTGAQNIKLNDYVPVALAGATLPGGKKISKGKLRGIESNGMMCS
IEELGLTREDYPDAPEDGIYILEPGVELGKDIKEVLGINETSFEFEITSNRPDCLSIIGL
AREAAVTLKKEFKKPQIKVLEEGDEAKNYISVEIKDPDLCPRYAARVVKDVKIGPSPKWM
RDRLRAAGVRPINNIVDITNYVMLEYGQPMHAFDLKDIQGNKIIVRRALEGETIKTLDDQ
DRKLDPSMLVIADENRAVAVAGVMGGANSEITDNAKTILFESANFNGTSVRLTSKKLGLR
TEASSRFEKGLDVENVVPALERAVQLVEELGAGTVCKGIVDCYVKKPEQVTLTLRPDKIN
ALLGTDISKEEMINILKALEFEIDESTNTVKVPSFRPDVEREADLAEEIARFYDYNNIQP
TLLSGKEATLGKKTYKQRIEDLIKDTMISCGLYETFTYSFTSPKDFEKLNIPQDSDLRKA
VVISNPLGEDYSIMRTTTIADMLRVISTNYNRRIEEARLFEMSFVYLPESLPVKELPKEK
PVLTIGMYGKTDFYELKGIVEELLSRLGIKEYEFVPVKDNPTFHPGRTASLTINGEYVGI
IGEIHPVVSENFECPERTYVAEMEIEKFVKHASLESQYKPLPKFPAVSRDIAMLVKDEIL
VKQIEDIIKQRAGKILEDVKLFDVYKGKQVPEGMKSVAYSITFRASDRTLTDEEVGKAMA
KILDGLKNNLGAQLRE
Download sequence
Identical sequences G8LZS1
gi|374295705|ref|YP_005045896.1| WP_014254586.1.34793 WP_014254586.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]