SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374296033|ref|YP_005046224.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296033|ref|YP_005046224.1|
Domain Number 1 Region: 1-77,158-324
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.59e-68
Family Bacterial dinuclear zinc exopeptidases 0.00000521
Further Details:      
 
Domain Number 2 Region: 65-144
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.00000000000000336
Family Aminopeptidase/glucanase lid domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374296033|ref|YP_005046224.1|
Sequence length 325
Comment peptidase family protein [Clostridium clariflavum DSM 19732]
Sequence
MFELIKRLTQSFGVSGNEEEIRETIINEIKNDIQEIRVDTLGNLIATKPGKGKKIMVAAH
MDEIGVMATYIDEKGFIRFSNIGGVSAFVSLGQKVKFKNGTVGAVFYEDKLEDMKNLKLS
KMYIDIGAKDKKEAEKLVRIGDVACFVGDAVRQGDMVISKAIDDRSGCAVLIEAIKRLPQ
TDNEIYFVFTVQEELGLRGAKTAAYQLKPDIAIAVDVTATGDTPEANLMEVKCGGGPAIK
IKDRSVICHPEVKKLLEESARNINIPYQFEVLEYGGSDPGAIHISAGGVPSGAISIPCRY
LHSPVEAASLEDIENAVKLLIEAIK
Download sequence
Identical sequences G8LSJ6
gi|374296033|ref|YP_005046224.1| WP_014254889.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]