SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374296174|ref|YP_005046365.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296174|ref|YP_005046365.1|
Domain Number 1 Region: 21-120,253-474
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.64e-101
Family Bacterial dinuclear zinc exopeptidases 0.000000206
Further Details:      
 
Domain Number 2 Region: 121-252
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 8.24e-36
Family Aminopeptidase/glucanase lid domain 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374296174|ref|YP_005046365.1|
Sequence length 484
Comment aspartyl aminopeptidase [Clostridium clariflavum DSM 19732]
Sequence
MADNKTQGQILSEKLLIESKSAWEKISDEEFRLTFDLCERYKTFLNKAKTEREFVEETEK
LAKSKGYIAIEELINSQKKLMPGMKVYSIGRNKTVVLAVIGEESLEKGVNIVGAHIDSPR
IDLKPNPVYEANDMVFLKTHYYGGIKKYQWVTIPLAMHGVVVKRDGSKVNIKIGEDDNDT
VFTITDLLPHLAADQMQKKMSEGITGEGLNILSGSIPYKDDKVKDKVKLNILNILNEKYG
IVEEDLISAELEMVPKFNAVDVGFDKSMIGAYGQDDRVCAYTALEAILDTEKVKRTAVCI
LTDKEEIGSMGNTGAQSSFFVNFLADLCSLSVDNYNDIMLRRCLSNSKMLSADVNAAIDP
TYENVYEKRNSSFLGRGIVLQKYTGARGKSGASDANAEFVGEIRKLFNDNNVVWQSAELG
KVDQGGGGTIAQFIANLNVDVIDCGVAVLSMHSPFEVTSKVDVYMAYKAYKTFYINLVKE
INFD
Download sequence
Identical sequences G8LU53
WP_014255026.1.34793 gi|374296174|ref|YP_005046365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]