SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374297996|ref|YP_005048187.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374297996|ref|YP_005048187.1|
Domain Number 1 Region: 171-304
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 9.81e-60
Family Peptidoglycan hydrolase LytM 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|374297996|ref|YP_005048187.1|
Domain Number - Region: 76-169
Classification Level Classification E-value
Superfamily FlgN-like 0.00183
Family FlgN-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374297996|ref|YP_005048187.1|
Sequence length 307
Comment metalloendopeptidase-like membrane protein [Clostridium clariflavum DSM 19732]
Sequence
MRKRSKVKRDKYLSIMFVPHSTNEIKTFKISSWRSKLYIFTAIVLALVIGFTSYLGNIIH
TNNKLKIALDEANSKNEEQARLLAENAEQIAALLEKERQYAENISEFSEKYKQMTENYLD
SNMESLTASRGSNSRSFIDDASELREILEKLRNINDSDDSIANKLSESEKKLQSYIETFP
TLWPADGPISSPFGYRTDPIYSSERKHEGIDIAAPYGADIRASATGKVIFSGTNGNYGKC
IIINHNNGITTLYGHASSLLAKEGQTVKKGDVIAKVGSTGKSTGPHLHFEVRINGTPDDP
LKYLDKK
Download sequence
Identical sequences G8M1N4
WP_014256766.1.34793 gi|374297996|ref|YP_005048187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]