SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CRE04729 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE04729
Domain Number 1 Region: 54-105
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.00000000000000445
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00085
Further Details:      
 
Domain Number 2 Region: 3-50
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000152
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE04729   Protein: RP04592   Gene: WBGene00055616
Sequence length 135
Comment RP04592 WBGene00055616 status:Predicted
Sequence
MSSYALYRGTTLGQALEQTLNDMEEEGLLPKSLVSKVLNQFDKSMNKQISRLPKEKMNFC
ASQLLTYRYCDNVWTFILNNVTLKDPQRSFDDPIDKLKIVACDGRQTNLLQNMSGQGSSK
RVARAAGDDDDDDSD
Download sequence
Identical sequences E3LYY0
CRE04729 XP_003110917.1.11157 31234.CRE04729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]