SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CRE10211 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE10211
Domain Number 1 Region: 72-295
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.04e-48
Family PP-loop ATPase 0.042
Further Details:      
 
Weak hits

Sequence:  CRE10211
Domain Number - Region: 303-324
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0209
Family Recombination protein RecR 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE10211   Protein: RP36974   Gene: WBGene00059510
Sequence length 390
Comment RP36974 WBGene00059510 locus:Cre-tut-1 status:Predicted
Sequence
MEKRRGPPPCQSKKGCSNPAKIRKAKDGSQLCGPCFSKNFEDDVHETIVNNNLFKVRKNS
IQFVVSFSHCSFLQRGERVAIGASGGKDSTVLAYVMKTLNDIHDYGLDLQLLSIDEGIKG
YRDDSLLAVEKNRIEYELPLTILSYNDLYGWTMDDIVAKIGKKNNCTFCGVFRRQALDRG
AFKIGATKLVTGHNADDMAETVLMNVLRGDIARLERCTNIVTGEEGDLPRAKPLKYCFER
DIVMYARTNQLEYFYTECIYAPNAYRGYARKYVRDLEKVHPRAILDLIRSGEKVSVKKEV
EMPTLKTCERCGYMTSQKMCKACLLIEGLNTGNTDLGVRKSKKSKKVIVEIEGEKKEEGC
GSGGGGCGCAGAADETENEETRKRLKDLQF
Download sequence
Identical sequences E3M6Y1
CRE10211 31234.CRE10211 XP_003108211.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]