SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CRE16599 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE16599
Domain Number 1 Region: 3-310
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 1.11e-64
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE16599   Protein: RP49713   Gene: WBGene00084643
Sequence length 314
Comment RP49713 WBGene00084643 status:Predicted
Sequence
MPVVLLLLFGMLCIASLLLGAQQIAWSDLFSASSDAWLTLSASRIPRLITIVLTGVGLSV
CGVILQHIVRNRFVEPGTTGSLDAAKLGILVSLTLIPAASVLSKMLFAMLFCFLASLIYI
AIIRRIQFRNTVLVPVIGLMYGGILSALAEFYAYRNNILQSMQGWLMGDFSRVIQGHYEM
IYIILPIVVLSYVFAHRFTVLGMGEEMASSLGLGYARMAAIGLLLVAITVAATVITVGAI
PFVGLVVPNLVALMYGENLAKTLPIVALAGASLLLVCDLIGRSVLYPFEVPIGLTAGGVG
GVLFLMLILRGLRS
Download sequence
Identical sequences A0A072D1M7 E3NWY5
WP_034610632.1.55951 XP_003087086.1.11157 31234.CRE16599 CRE16599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]