SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CRE17760 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE17760
Domain Number 1 Region: 82-310
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 8.89e-83
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00000271
Further Details:      
 
Domain Number 2 Region: 11-82,311-511
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.53e-70
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE17760   Protein: RP10293   Gene: WBGene00074743
Sequence length 515
Comment RP10293 WBGene00074743 status:Predicted
Sequence
MTDATAGKIPHVLVIMDGVGHREAVEDNAFLAAKTPNLTMMQEKHPHSLISGSGEDVGLP
DGQMGNSEVGHMNLGAGRVLYQDFTRITKDIRTGDFFEHEVLIDAVEKAKAANGALHIMG
LLSEGGVHSHQDHIIAMCELALKRGAKVYLHAFLDGRDTPPRSAKPSLEKLDAVFAQYPN
QGRIATMIGRYFAMDRDNRWDRVEQAYRLMTEGEALRVVDSAVEGLEQAYSANENDEFVK
ATRIGEIAKIQDGDSVVFMNFRADRAREITKAFVEQDFAGFERKVVPHLSKFVMLTRYQA
TIDAPVAYMPEGLKNSIGEYLSSLGKTQLRIAETEKYAHVTFFFSGGREDEYPGEKRILI
PSPKVATYDLQPEMSAPEVTDKLVDAINSGEFDLLVVNYANGDMVGHTGVFDAAVKAVEA
VDTSLGRLYEAVMAKHGHMLITADHGNVEQMQDYVSGQVHTQHTTELVPFIYVGPSSATI
AEGGVLADVAPTILSLMHLPVPTEMQGRNLITLKA
Download sequence
Identical sequences A0A072CXG9 A0A077KZE2 E3NSS4
31234.CRE17760 CRE17760 WP_034613550.1.55951 XP_003088549.1.11157 XP_005979518.1.78601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]