SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CRE20924 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE20924
Domain Number 1 Region: 5-51
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 6.54e-16
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.001
Further Details:      
 
Domain Number 2 Region: 54-106
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.00000000000000392
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE20924   Protein: RP04789   Gene: WBGene00071070
Sequence length 117
Comment RP04789 WBGene00071070 status:Predicted
Sequence
MEKPNYQLYRNTTLGQALQKTLDDFVSEQIIPDSLSKKVMDSFDKSINRILPMKAKNKVN
FRAEKLRAYRYCDNVWTFIVEQVDLKEAIDPNGPVNRLKIVACDGQTKGQIGGAGHA
Download sequence
Identical sequences E3N924
XP_003095089.1.11157 31234.CRE20924 CRE20924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]