SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CRE24737 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE24737
Domain Number 1 Region: 83-315
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 2.09e-77
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0000051
Further Details:      
 
Domain Number 2 Region: 11-83,320-518
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.49e-72
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE24737   Protein: RP28634   Gene: WBGene00070244
Sequence length 521
Comment RP28634 WBGene00070244 status:Partially_confirmed
Sequence
MAMANNGKVANKVCLIVIDGWGISDDPYGNAILNAQTPVMDKLCSGNWAQIEAHGLHVGL
PEGLMGNSEVGHLNIGAGRVIYQDIVRINLAVKNNQLVNNENLVDACNRAKNGNGRLHLA
GLVSDGGVHSHIDHMFALIKAIKELGVPELYLHFYGDGRDTSPNSGVGFLEQTLEYLEKT
VGYGKLATVVGRYYAMDRDKRWERINVAYEAMIGGVGETSDETGVVEVVRKRYAADETDE
FLKPIILQGEKGRVQNDDTLVFFDYRADRMREISEVMGMERYKDCNSKLAHPSNVQVYGM
TQYKAEFPFKSLFPPASNKNVLAEWLAEQKVSQFHCAETEKYAHVTFFFNGGLEKQFEGE
ERSLVPSPKVATYDLQPEMSAAGVADKMLEQIEAGTHPFIMCNFAPPDMVGHTGVYEAAV
KACEATDVAIGRIYEATQKHGYSLMVTADHGNAEKMKAPDGGKHTAHTCYRVPLTLSHPG
FKFVDPADRHPALCDVAPTVLAIMGLPQPAEMTGASIVQKI
Download sequence
Identical sequences E3N948
XP_003095056.1.11157 31234.CRE24737 CRE24737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]