SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CRE27199 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE27199
Domain Number 1 Region: 301-357
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 7.59e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00032
Further Details:      
 
Domain Number 2 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000011
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE27199   Protein: RP20923   Gene: WBGene00052699
Sequence length 357
Comment RP20923 WBGene00052699 locus:Cre-pqn-51 status:Confirmed
Sequence
MAHGNGIADIYKSVIADVISNMKEAFLDENIDVDVLSQLKKEWEDKVNSSGCVDLESNAP
PPAPRQQHVTPNPVRPNPIPNHRINPNVQQQQPQRSALAALHAAQMGDTPIRMAYTAQTV
QHPQQVRMFPQQFQGGMPFQPGQVFVVQQPGGQNLPMTIMPNQLQHRIVQQGQPQQIPQH
QQGNQLTHMNMNQMDGNGGSESDDEGCSEPLHVRQKKAKASMKVRGTGASKKEAMKVLGS
MLKEIQLDGGGGGMSDSSSEEEGEEDDDPLRRIADRMGNGEVEDGDQVAEEEPLNSEDDQ
SDDEDLTMLFDAENVVMCQFEKVNRARTKWKFQLKDGIMHIDKKDYCFQKCTGEAEW
Download sequence
Identical sequences E3LP02
XP_003114108.1.11157 31234.CRE27199 CRE27199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]