SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CRE00950 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE00950
Domain Number 1 Region: 22-175
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.84e-29
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE00950   Protein: RP34875   Gene: WBGene00052108
Sequence length 370
Comment RP34875 WBGene00052108 status:Predicted
Sequence
MKSIIIAFLVALAISPASDRTFSPKSEYVYKFDGLILSGVPTTSSDTSQTRISCRTRIQV
IDDRYIHLQLTDVTYSASHIPQTEQWPKMESLEQRELSDELRKFLELPIRVQMRNGLISE
IQSSSEDAEWSKNEKRSIVNLLSLHRSAPVDELNQEEKDMETEKDSRFFNVYEKTMESCK
VDQSEVSAFENITYSAPPLTTGFSLVSKDFSEQPTFAVSSKKINKNNDDYWPRCLQCRSS
LGDVAAVSSELKLHIHSFYVQILTPTISNVAALWHFGCKLNSINWRLCTTTADIVAKTIN
QIASKLFPKFSDKTASRHVGCSQILKICPDKVGIDREIGDSQRVGSRTLDLNLDIECTQG
SRRCLDATCV
Download sequence
Identical sequences E3LD15
CRE00950 31234.CRE00950 XP_003118331.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]