SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CRE02695 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CRE02695
Domain Number 1 Region: 84-197
Classification Level Classification E-value
Superfamily PapD-like 0.00000000000654
Family MSP-like 0.024
Further Details:      
 
Domain Number 2 Region: 222-321
Classification Level Classification E-value
Superfamily PapD-like 0.0000000576
Family MSP-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE02695   Protein: RP33138   Gene: WBGene00070050
Sequence length 402
Comment RP33138 WBGene00070050 status:Predicted
Sequence
MQNYSGGEHKSGSGKGFPSKLMGRGLIFLWNIANALHLTLLETPFEIHQGQVRQEFEKLH
HDGKSLLTASDLPEDKYIVFCGLLELTNRACVHFELRNPTQKTILFNIRTPISHCFFVKP
HVGMIEAGGKAKIYCTFKGKCHRVPSDYCMIYSIYHIVIDEKSTALIKEDEFSSSNLRAV
WNKKGRGVEIKNILHLSCKFDEKAKPEHTCKHHKIGRIIDLNDHGETILFNIRTPISHCF
FVKPHVGMIEAGGKAKIYCTFKGKCHRVPSDYCMIYSIYHIVIDEKSTALIKEDEFSSSN
LRAVWNKKGRGVEIKNILHLSCKFDEKAKPEHTCKHHKIGRIIDLNDHGEVVQASPLEDS
KGEPSNTPPSATAKGRRLQKTPSVISTEEMPKTATSEKTKKK
Download sequence
Identical sequences E3NKJ1
CRE02695 31234.CRE02695 XP_003091080.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]