SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CRE15109 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CRE15109
Domain Number - Region: 189-214
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00418
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE15109   Protein: RP08868   Gene: WBGene00073340
Sequence length 382
Comment RP08868 WBGene00073340 status:Predicted
Sequence
MTDPNTETINEDGQKLSEYGVLKDDKLPAMPVEGNTHEEPSADGKAIVSVKETEEAAKLR
ESQEEKILSIQTAYYLVAGKIDTLEKESEAHRDVLDQIATDQSNLSEKIDQQMSTKADLQ
CVQLGIENEVSRLKEAVKELKHRLLGEPKESPLDCFSPSPFKIPKMSEKRGPTGEIEENS
SSITRKSLKDCPLCRDSGHRLADCPQFASKLEKLQQFRKRQICCTCGNLQCSRINCPKAT
IQCQICKGKQEFGKTLHISEICIFETHVSKRPSQTEYRRQKFSAQRPRSKSPAKENQAAT
QGPQPAQLQQQMVQQQYQQQPMMPTGPAFGPGYQMNSMIPPQQYQYQHPQQMVPMPMQPI
PLQQYGYYQQQPGPSNQTTHHQ
Download sequence
Identical sequences E3NN75
31234.CRE15109 CRE15109 XP_003090146.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]